Practical knowledge for building, securing, and scaling your agency. Technical workflows and strategic insights from a hands-on cloud infrastructure partner.https://webnestify.cloud/en-ushttps://webnestify.cloud/insights/cybersecurity-hardening/hermes-agent-deployment/https://webnestify.cloud/insights/cybersecurity-hardening/hermes-agent-deployment/Hermes Agent: the secure AI agent infrastructure pattern I ship for companies. Gateway/sandbox split, rootless Docker, scoped tokens, monthly restore drills.Sat, 23 May 2026 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsoperations-automationhermes-agentai-agentsself-hosted-ai-agentprivate-aiprompt-injectionrootless-dockerdocker-hardened-imagessandbox-isolationtailscaleresticllm-securitysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/secure-self-hosted-stoat-discord-alternative/https://webnestify.cloud/insights/open-source-solutions/secure-self-hosted-stoat-discord-alternative/Discord's age-verification stack leaked 70,000 IDs. Here is how to migrate your community to a properly hardened, self-hosted Stoat server on Docker.Thu, 14 May 2026 00:00:00 GMTopen-source-solutionscybersecurity-hardeningtechnical-blueprintsstoatrevoltdiscord-alternativeself-hosteddocker-hardeningcontainer-securitylivekitgarage-s3caddysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cloud-infrastructure/xcloud-security-review-secure-by-default/https://webnestify.cloud/insights/cloud-infrastructure/xcloud-security-review-secure-by-default/I audited xCloud's Docker hosting. The isolation, AppArmor, and per-app users are solid. Here are the daemon and compose defaults they should ship next.Thu, 14 May 2026 00:00:00 GMTcloud-infrastructurecybersecurity-hardeningtechnical-blueprintsxclouddocker-hardeningsecure-by-defaultcontainer-securitydocker-daemonapparmordocker-composeleast-privilegeresponsible-disclosuresimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/defense-in-depth-web-application-architecture/https://webnestify.cloud/insights/cybersecurity-hardening/defense-in-depth-web-application-architecture/Defense in depth is what actually keeps a web application secure: seven concentric, independent layers from the perimeter to the database. Boring decisions that compound.Tue, 12 May 2026 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintscloud-infrastructuredefense-in-depthapplication-securitysecure-architecturehardened-containersssolayered-securityweb-securitysecurity-architecturesimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/dirty-frag-linux-kernel-lpe/https://webnestify.cloud/insights/cybersecurity-hardening/dirty-frag-linux-kernel-lpe/Dirty Frag is a new Linux kernel LPE in the Dirty Pipe and Copy Fail family. Here is the bug, the CVE pair, and how we mitigated it in two hours.Fri, 08 May 2026 00:00:00 GMTcybersecurity-hardeningoperations-automationlinux-kernelcvedirty-fragzero-dayprivilege-escalationpatch-managementincident-responsesimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/copy-fail-cve-2026-31431/https://webnestify.cloud/insights/cybersecurity-hardening/copy-fail-cve-2026-31431/Copy Fail (CVE-2026-31431) gave attackers root on nearly every Linux server. Here's what the bug does and how I patched our managed fleet on day zero.Thu, 30 Apr 2026 00:00:00 GMTcybersecurity-hardeningoperations-automationlinux-kernelcvezero-dayprivilege-escalationpatch-managementincident-responsesimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cloud-infrastructure/serverless-hosting-hidden-costs/https://webnestify.cloud/insights/cloud-infrastructure/serverless-hosting-hidden-costs/An honest take on the hidden costs of Vercel, Netlify, Cloudflare Pages, and Railway: surprise bills, lock-in, and outages an agency can't afford.Tue, 28 Apr 2026 00:00:00 GMTcloud-infrastructureagency-growth-strategyserverlesshostingvercelnetlifycloudflare-pagesrailwayvendor-lock-inagencysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/agency-growth-strategy/you-are-the-brain-ai-is-the-tool/https://webnestify.cloud/insights/agency-growth-strategy/you-are-the-brain-ai-is-the-tool/26 hours and $200 building Webnestify Hub with AI tools. The 14-hour spec, the security gaps AI won't fix on its own, and the deployment war that 'build with AI in 60 minutes' demos never show.Fri, 13 Feb 2026 00:00:00 GMTagency-growth-strategycybersecurity-hardeningtechnical-blueprintsai-assisted-developmentwebnestify-hubclaude-codedocker-hardeningproduction-deploymentspec-driven-developmentsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/cybersecurity-human-right-webnestify-education/https://webnestify.cloud/insights/cybersecurity-hardening/cybersecurity-human-right-webnestify-education/Cybersecurity is no longer a technical concern; it's tied to safety, privacy, and dignity. Why I'm founding Webnestify Education, a non-profit for accessible digital safety training.Wed, 03 Dec 2025 00:00:00 GMTcybersecurity-hardeningagency-growth-strategyhuman-rightscybersecurity-educationdigital-literacywebnestify-educationai-deepfakesdigital-inequalitynon-profitsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/open-source-as-business-strategy/https://webnestify.cloud/insights/open-source-solutions/open-source-as-business-strategy/n8n raised $180M at a $2.5B valuation. Pangolin closed a YC seed round. Netbird hit $5.4M. Open-source isn't a community hobby anymore; it's a business model that's beating closed-source incumbents.Fri, 10 Oct 2025 00:00:00 GMTopen-source-solutionsagency-growth-strategyopen-sourcen8npangolinnetbirdbusiness-modelventure-capitalberlin-startupssimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cloud-infrastructure/self-hosted-control-panel-enhance-vs-saas/https://webnestify.cloud/insights/cloud-infrastructure/self-hosted-control-panel-enhance-vs-saas/SaaS control panels need root access to your servers. After years of using them, I moved to Enhance, a self-hosted panel. The trade-offs, the migration story, and where SaaS still fits.Sat, 09 Aug 2025 00:00:00 GMTcloud-infrastructurecybersecurity-hardeningagency-growth-strategycontrol-panelenhanceself-hostedsaas-riskscpanelpleskploihosting-infrastructuresimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/mixing-personal-business-devices-security/https://webnestify.cloud/insights/cybersecurity-hardening/mixing-personal-business-devices-security/How a routine insurance renewal turned into a real-world cybersecurity demonstration. The risks of mixing personal and business devices, and the practical fixes that actually work.Sun, 16 Mar 2025 00:00:00 GMTcybersecurity-hardeningagency-growth-strategypersonal-vs-businesscybersecurity-educationbitwardenesetkasmnetwork-segmentationhome-network-securitybring-your-own-devicesimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/operations-automation/ai-wordpress-automation-deepseek-n8n-baserow/https://webnestify.cloud/insights/operations-automation/ai-wordpress-automation-deepseek-n8n-baserow/How I run AI WordPress automation in production: a self-hosted n8n + Baserow + DeepSeek stack that drafts posts at 2% of GPT-4 cost without SEO penalty.Fri, 03 Jan 2025 00:00:00 GMToperations-automationtechnical-blueprintsopen-source-solutionsai-automationwordpressn8nbaserowdeepseekself-hostedcontent-automationdockersimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/2fauth-self-hosted-2fa-manager/https://webnestify.cloud/insights/cybersecurity-hardening/2fauth-self-hosted-2fa-manager/How I deploy 2FAuth as a self-hosted 2FA vault: the Docker stack, the proxy in front, the backup discipline, and why I keep it behind a VPN.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsopen-source-solutions2fauthself-hosted-2fatotptwo-factor-authenticationdockerwebauthnnginx-proxy-manageraccount-securitysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/authentik-self-hosted-identity-provider/https://webnestify.cloud/insights/cybersecurity-hardening/authentik-self-hosted-identity-provider/How I deploy Authentik as a self-hosted identity provider: the Docker stack, the Postgres and Redis pieces, the SSO flows, and when SSO is overkill.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsopen-source-solutionsauthentikself-hosted-ssoidentity-provideroauth2samlmfadockerssosimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/bookstack-documentation-wiki-deployment/https://webnestify.cloud/insights/open-source-solutions/bookstack-documentation-wiki-deployment/How I deploy BookStack as a self-hosted documentation wiki: the Docker stack, the proxy, the backup discipline, and why it beats Notion for agencies.Sat, 28 Dec 2024 00:00:00 GMTopen-source-solutionstechnical-blueprintsagency-growth-strategybookstackself-hosted-wikidocumentationknowledge-basedockerlinuxservermariadbagency-operationssimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/operations-automation/code-server-vscode-browser-deployment/https://webnestify.cloud/insights/operations-automation/code-server-vscode-browser-deployment/How I deploy code-server for a portable VS Code in the browser: the Docker stack, the proxy in front, and the workspace-backup rule that saved a week of work.Sat, 28 Dec 2024 00:00:00 GMToperations-automationtechnical-blueprintsopen-source-solutionscode-servervs-code-browserself-hosteddockerlinuxserver-ioremote-developmentcloudflare-tunnelsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/crowdsec-installation-server-protection/https://webnestify.cloud/insights/cybersecurity-hardening/crowdsec-installation-server-protection/How I install CrowdSec on every fresh Ubuntu server: package repo, firewall bouncer, the collections worth running, and the console wiring that closes the loop.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsopen-source-solutionscrowdsecserver-securityintrusion-detectionfail2ban-alternativeubuntu-hardeningfirewall-bouncercsclivps-securitysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/crowdsec-wordpress-integration/https://webnestify.cloud/insights/cybersecurity-hardening/crowdsec-wordpress-integration/How I wire CrowdSec's WordPress bouncer to the LAPI on the same server, what bouncing level to pick, and the failure modes I've watched it catch in production.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsopen-source-solutionscrowdsecwordpress-securitycrowdsec-bouncerlapiwordpress-bouncerbrute-force-protectionapplication-firewallwordpress-hardeningsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/cryptgeon-self-hosted-secret-sharing/https://webnestify.cloud/insights/cybersecurity-hardening/cryptgeon-self-hosted-secret-sharing/How I deploy Cryptgeon as a self-hosted secret sharing service: the Compose file, the TTL defaults I trust for client onboarding, and the proxy in front.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsopen-source-solutionscryptgeonself-hosted-secret-sharingone-time-secretsend-to-end-encryptiondockerprivnote-alternativeclient-onboardingagency-securitysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cloud-infrastructure/cyberpanel-installation-guide/https://webnestify.cloud/insights/cloud-infrastructure/cyberpanel-installation-guide/How I install CyberPanel on a fresh Ubuntu box, harden the LiteSpeed admin, enforce TLS 1.3, and turn on the LSCache crawler for agency WordPress hosting.Sat, 28 Dec 2024 00:00:00 GMTcloud-infrastructuretechnical-blueprintsopen-source-solutionscyberpanelopenlitespeedlitespeed-enterpriselscachewordpress-hostingcontrol-paneltls-1-3agency-hostingsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/docuseal-self-hosted-document-signing/https://webnestify.cloud/insights/open-source-solutions/docuseal-self-hosted-document-signing/How I deploy DocuSeal as a self-hosted DocuSign alternative: the Compose file, eIDAS reality, audit-trail storage, and when paying DocuSign actually wins.Sat, 28 Dec 2024 00:00:00 GMTopen-source-solutionstechnical-blueprintsagency-growth-strategydocuseale-signatureself-hosteddocusign-alternativehellosign-alternativedockereidaspostgressimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cloud-infrastructure/enhance-control-panel-installation/https://webnestify.cloud/insights/cloud-infrastructure/enhance-control-panel-installation/How I install Enhance control panel on Hetzner: the multi-server topology, the Cloudflare guardrails, and when the operational tax is worth paying.Sat, 28 Dec 2024 00:00:00 GMTcloud-infrastructuretechnical-blueprintsenhancecontrol-panelweb-hostinghetznercloudflaremulti-servercpanel-alternativeagency-hostingsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/human-element-cybersecurity-defense/https://webnestify.cloud/insights/cybersecurity-hardening/human-element-cybersecurity-defense/Most breaches I see start with a person, not a packet. Here's the human-layer playbook for routers, DNS, passwords, and the social engineering no firewall stops.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeninghuman-element-cybersecuritysocial-engineeringphishingpassword-managerssecure-dnsrouter-security2fasecurity-awarenesssimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/immich-self-hosted-photo-backup/https://webnestify.cloud/insights/open-source-solutions/immich-self-hosted-photo-backup/How I run Immich as a self-hosted Google Photos replacement: the Compose stack, Caddy in front, sizing reality, and when paying Google is still the right call.Sat, 28 Dec 2024 00:00:00 GMTopen-source-solutionstechnical-blueprintsimmichself-hosted-photosgoogle-photos-alternativephoto-backupdockercaddymachine-learningprivacysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/operations-automation/it-tools-self-hosted-developer-utilities/https://webnestify.cloud/insights/operations-automation/it-tools-self-hosted-developer-utilities/How I deploy IT Tools self-hosted as the JWT decoder, hash generator, and JSON formatter that never sees the public internet, plus the reasons I stopped pasting tokens into random websites.Sat, 28 Dec 2024 00:00:00 GMToperations-automationtechnical-blueprintsopen-source-solutionsit-toolsself-hosteddockerdeveloper-toolsprivacyjwtjson-formatteroperationssimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/kasm-workspaces-browser-isolation/https://webnestify.cloud/insights/cybersecurity-hardening/kasm-workspaces-browser-isolation/How I deploy Kasm Workspaces for browser isolation on a single VPS, the Caddy proxy in front, and where remote browsers actually beat RDP and VDI.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsopen-source-solutionskasm-workspacesbrowser-isolationremote-browsercontainerised-desktopsvdicaddydockerself-hostedsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/linux-server-security-fundamentals/https://webnestify.cloud/insights/cybersecurity-hardening/linux-server-security-fundamentals/My 2026 Linux server security baseline: SSH bound to the Tailscale IP, public SSH gone, Ed25519 keys, root and password login off, UFW where it still counts.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintslinux-server-securityssh-hardeningssh-keysed25519tailscalemesh-vpnmeshcentralufwserver-firewallvps-securitysudo-usersshd-configsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/operations-automation/listmonk-self-hosted-newsletter-platform/https://webnestify.cloud/insights/operations-automation/listmonk-self-hosted-newsletter-platform/How I ship Listmonk for clients who want a Mailchimp replacement they actually own, plus the SMTP relay choices that decide whether the campaigns land.Sat, 28 Dec 2024 00:00:00 GMToperations-automationtechnical-blueprintsopen-source-solutionslistmonknewsletterself-hosteddockerpostgresqlemail-deliverabilitysmtp-relaygdprsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cloud-infrastructure/mailcow-self-hosted-email-server/https://webnestify.cloud/insights/cloud-infrastructure/mailcow-self-hosted-email-server/How I deploy Mailcow as a self-hosted email server: the Compose stack, the DNS records that decide deliverability, and when I tell clients to stay on Workspace.Sat, 28 Dec 2024 00:00:00 GMTcloud-infrastructuretechnical-blueprintsopen-source-solutionsmailcowself-hosted-emailemail-serverpostfixdovecotrspamddockeremail-deliverabilitysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/operations-automation/mautic-self-hosted-marketing-automation/https://webnestify.cloud/insights/operations-automation/mautic-self-hosted-marketing-automation/How I deploy Mautic for clients who refuse to ship lead data to HubSpot, plus the SMTP traps that make most self-hosted setups quietly fail.Sat, 28 Dec 2024 00:00:00 GMToperations-automationtechnical-blueprintsopen-source-solutionsmauticmarketing-automationself-hosteddockermariadbemail-deliverabilitygdprsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/operations-automation/meshcentral-self-hosted-remote-management/https://webnestify.cloud/insights/operations-automation/meshcentral-self-hosted-remote-management/How I deploy MeshCentral self-hosted to replace TeamViewer for agency client SLAs: the Docker stack, the proxy, and the agent install rules I never break.Sat, 28 Dec 2024 00:00:00 GMToperations-automationtechnical-blueprintsopen-source-solutionsmeshcentralremote-managementrmmdockernginx-proxy-managerself-hostedagency-operationssimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/mistborn-self-hosted-vpn-platform/https://webnestify.cloud/insights/cybersecurity-hardening/mistborn-self-hosted-vpn-platform/How I deploy Mistborn as a self-hosted VPN platform: the one-line install, the Pi-hole adlists I trust, the DoH switch, and where it beats raw Wireguard.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsopen-source-solutionsmistbornself-hosted-vpnwireguardpiholednscryptdohdebianprivate-cloudsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/operations-automation/n8n-self-hosted-workflow-automation/https://webnestify.cloud/insights/operations-automation/n8n-self-hosted-workflow-automation/How I deploy n8n self-hosted for agency clients: the Docker stack, the proxy in front, the credentials trap, and when it beats writing a Lambda.Sat, 28 Dec 2024 00:00:00 GMToperations-automationtechnical-blueprintsopen-source-solutionsn8nworkflow-automationself-hosteddockernginx-proxy-managerzapier-alternativelow-codesimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/nextcloud-aio-self-hosted-installation/https://webnestify.cloud/insights/open-source-solutions/nextcloud-aio-self-hosted-installation/How I deploy Nextcloud AIO as a self-hosted Google Workspace replacement: the Compose file, the proxy in front, sizing reality, and when to pay Google instead.Sat, 28 Dec 2024 00:00:00 GMTopen-source-solutionstechnical-blueprintsagency-growth-strategynextcloudnextcloud-aioself-hosted-cloudfile-collaborationdockernginx-proxy-managergoogle-workspace-alternativedropbox-alternativesimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/penpot-self-hosted-design-platform/https://webnestify.cloud/insights/open-source-solutions/penpot-self-hosted-design-platform/How I deploy Penpot as a self-hosted Figma alternative for design teams: the Compose stack, the Caddy proxy, sizing reality, and when Figma still wins.Sat, 28 Dec 2024 00:00:00 GMTopen-source-solutionstechnical-blueprintsagency-growth-strategypenpotself-hosted-designfigma-alternativedesign-collaborationdockercaddysvg-designdesign-systemssimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/perfex-crm-self-hosted-installation/https://webnestify.cloud/insights/open-source-solutions/perfex-crm-self-hosted-installation/How I deploy Perfex CRM self-hosted on a CyberPanel VPS: licensing reality, the PHP/MySQL stack, the operational tradeoffs, and when it beats SaaS on TCO.Sat, 28 Dec 2024 00:00:00 GMTopen-source-solutionstechnical-blueprintsagency-growth-strategyperfex-crmself-hosted-crmcyberpanelphp-mysqlcodecanyonsmall-business-crmclient-managementinvoicingsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/plausible-analytics-self-hosted-deployment/https://webnestify.cloud/insights/open-source-solutions/plausible-analytics-self-hosted-deployment/How I deploy Plausible self-hosted analytics for agency clients: the Compose file, the Cloudflare Tunnel in front, SMTP that actually delivers, and the costs.Sat, 28 Dec 2024 00:00:00 GMTopen-source-solutionstechnical-blueprintsoperations-automationplausible-analyticsself-hosted-analyticsprivacy-analyticsgdpr-compliant-analyticsgoogle-analytics-alternativedockercloudflare-tunnelpostgresclickhousehetznersimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cloud-infrastructure/portainer-nginx-proxy-manager-vaultwarden/https://webnestify.cloud/insights/cloud-infrastructure/portainer-nginx-proxy-manager-vaultwarden/How I deploy Portainer, Nginx Proxy Manager, and Vaultwarden together: the Docker stack, the gotchas, and the operational rules I'd tattoo on a junior engineer.Sat, 28 Dec 2024 00:00:00 GMTcloud-infrastructuretechnical-blueprintsopen-source-solutionsportainernginx-proxy-managervaultwardenself-hosteddockerbitwardenreverse-proxypassword-managersimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/agency-growth-strategy/self-hosted-agency-stack-foundations/https://webnestify.cloud/insights/agency-growth-strategy/self-hosted-agency-stack-foundations/The opinionated entry point to my self-hosted agency stack: the philosophy, the phased build order, and a deep-dive link for every tool in the archive.Sat, 28 Dec 2024 00:00:00 GMTagency-growth-strategyopen-source-solutionsfossself-hostedopen-sourceagencyhosting-stackgdpreuropean-agenciesinfrastructurebusiness-strategyvendor-lock-insimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/stirling-pdf-self-hosted-document-toolkit/https://webnestify.cloud/insights/open-source-solutions/stirling-pdf-self-hosted-document-toolkit/How I run Stirling PDF as a self-hosted alternative to ilovepdf.com and Adobe Acrobat for agency document work, with Compose file and Cloudflare Access.Sat, 28 Dec 2024 00:00:00 GMTopen-source-solutionstechnical-blueprintsoperations-automationstirling-pdfself-hostedpdf-toolsdockercloudflare-accessdocument-privacyocrlibreofficesimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/operations-automation/uptime-kuma-self-hosted-monitoring/https://webnestify.cloud/insights/operations-automation/uptime-kuma-self-hosted-monitoring/How I deploy Uptime Kuma for client environments: the Docker stack, the proxy in front, and the notification traps I keep watching agencies fall into.Sat, 28 Dec 2024 00:00:00 GMToperations-automationtechnical-blueprintsopen-source-solutionsuptime-kumaself-hosted-monitoringdockernginx-proxy-managerwatchtowerobservabilitysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/vikunja-self-hosted-task-management/https://webnestify.cloud/insights/open-source-solutions/vikunja-self-hosted-task-management/How I deploy Vikunja as a self-hosted task manager for an agency: the Compose stack, the Nginx reverse proxy quirk, mail config, and when to skip Trello.Sat, 28 Dec 2024 00:00:00 GMTopen-source-solutionstechnical-blueprintsoperations-automationvikunjatask-managementself-hostedkanbandockernginx-proxy-managertrello-alternativeasana-alternativesimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/wireguard-easy-self-hosted-vpn/https://webnestify.cloud/insights/cybersecurity-hardening/wireguard-easy-self-hosted-vpn/How I deploy WireGuard Easy as a self-hosted VPN: the Compose file, the config trade-offs, and why wg-easy is my default for client-scale tunnels.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsopen-source-solutionswireguardwg-easyself-hosted-vpndockervpnnetwork-securityhomelabremote-accesssimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/wirehole-vpn-server-deployment/https://webnestify.cloud/insights/cybersecurity-hardening/wirehole-vpn-server-deployment/How I deploy Wirehole as a self-hosted VPN: Docker Compose on Ubuntu, the Unbound version pin that bites everyone, and where it beats raw Wireguard.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsopen-source-solutionswireholewireguardpiholeunboundself-hosted-vpndocker-composedns-over-tlsubuntusimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/wordpress-admin-account-recovery/https://webnestify.cloud/insights/cybersecurity-hardening/wordpress-admin-account-recovery/How I recover a locked-out WordPress admin: a clean WP-CLI path when SSH still works, and a SQL-only fallback through phpMyAdmin when it doesn't.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintswordpress-admin-recoverywordpress-password-resetphpmyadminwp-cliwp-userswp-usermetawordpress-securitylocked-out-wordpresssimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/wordpress-server-security-comprehensive-guide/https://webnestify.cloud/insights/cybersecurity-hardening/wordpress-server-security-comprehensive-guide/The full WordPress server security pass I run on every production site: server baseline, WordPress hardening, headers, 2FA, and the plugins worth their CPU.Sat, 28 Dec 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsopen-source-solutionswordpress-securitywordpress-server-securitywp-hardeninghtaccesssecurity-headersxml-rpcwordfencetwo-factor-authenticationphp-hardeningvps-securitysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/netbird-zero-trust-mesh-vpn/https://webnestify.cloud/insights/cybersecurity-hardening/netbird-zero-trust-mesh-vpn/How Netbird, an open-source mesh VPN built on WireGuard, fits a Zero Trust security posture for remote teams: peer-to-peer encryption, per-peer access control, and no central concentrator to bottleneck.Sat, 17 Aug 2024 00:00:00 GMTcybersecurity-hardeningopen-source-solutionsnetbirdwireguardzero-trustmesh-vpnvpnremote-worknetworkingsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/flarum-self-hosted-community-forum/https://webnestify.cloud/insights/open-source-solutions/flarum-self-hosted-community-forum/Flarum is an open-source PHP forum with a Mithril frontend and a 1,200+ extension ecosystem. Why I recommend it for small-to-mid-size communities over Discourse, Discord, and Reddit.Fri, 12 Jul 2024 00:00:00 GMTopen-source-solutionsagency-growth-strategyflarumforumcommunity-platformphpself-hostedopen-sourcediscussionsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/pikapods-managed-self-hosted-apps/https://webnestify.cloud/insights/open-source-solutions/pikapods-managed-self-hosted-apps/PikaPods is a managed hosting service for self-hosted open-source apps from the BorgBase team. From $1/month, no sysadmin skills required. Where it fits and where it doesn't.Fri, 05 Jul 2024 00:00:00 GMTopen-source-solutionscloud-infrastructurepikapodsself-hostingopen-sourcemanaged-hostingborgbasepeakfordsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/mistborn-zero-trust-vpn-suite/https://webnestify.cloud/insights/cybersecurity-hardening/mistborn-zero-trust-vpn-suite/Mistborn is an open-source Zero Trust VPN suite built on WireGuard, Pi-hole, Wazuh, and Suricata, with a CISSP/OSCP-led security model. How it fits, when to choose it, and what the Webnestify managed-Mistborn engagement covers.Fri, 31 May 2024 00:00:00 GMTcybersecurity-hardeningopen-source-solutionsmistbornzero-trustwireguardvpnself-hostedpi-holewazuhsuricatasimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/technical-blueprints/wordpress-wp-cli-command-line-management/https://webnestify.cloud/insights/technical-blueprints/wordpress-wp-cli-command-line-management/WP-CLI is the command-line tool for WordPress that turns 30-minute admin tasks into 30-second commands. Why I run it on every managed WordPress site and the commands worth memorizing.Thu, 09 May 2024 00:00:00 GMTtechnical-blueprintsopen-source-solutionswp-cliwordpresscommand-lineautomationagency-workflowsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/secure-work-environments-virtual-machines/https://webnestify.cloud/insights/cybersecurity-hardening/secure-work-environments-virtual-machines/How virtual machines isolate business work from personal devices, what to harden inside them, and when a managed Zero-Trust workspace fits better.Sat, 20 Apr 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintsvirtual-machineszero-trustworkspace-isolationvm-securityvdisecure-workspacessimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/borg-backups-encrypted-deduplicated-archive/https://webnestify.cloud/insights/cybersecurity-hardening/borg-backups-encrypted-deduplicated-archive/Borg is an open-source backup tool that combines deduplication, encryption, and compression so nightly backups of multi-terabyte servers don't fill the storage in a month. Why I run it on every managed server.Mon, 15 Apr 2024 00:00:00 GMTcybersecurity-hardeningopen-source-solutionsborgborgmaticborgbasebackupdeduplicationencryptiondisaster-recoverysimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/windows-server-hardening-dod-stigs-scap-lgpo-eset/https://webnestify.cloud/insights/cybersecurity-hardening/windows-server-hardening-dod-stigs-scap-lgpo-eset/How to harden a Windows Server using DoD STIGs (Security Technical Implementation Guides), the SCAP scanner, Microsoft's LGPO tool, and ESET's endpoint suite. The actual playbook and the realistic scope.Thu, 04 Apr 2024 00:00:00 GMTcybersecurity-hardeningtechnical-blueprintswindows-serverhardeningdod-stigscaplgpoesetsecuritycompliancesimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/zero-trust-security-overview/https://webnestify.cloud/insights/cybersecurity-hardening/zero-trust-security-overview/Zero Trust security is a stance, not a product. The conceptual primer to the rest of my Zero Trust series: what it actually means, the three core principles, and how to implement it without buying a vendor's reference architecture.Sat, 30 Mar 2024 00:00:00 GMTcybersecurity-hardeningzero-trustsecurity-architectureidentitymicrosegmentationmfacompliancesimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/wireguard-vpn-wg-easy-self-hosted/https://webnestify.cloud/insights/cybersecurity-hardening/wireguard-vpn-wg-easy-self-hosted/WireGuard plus WG-Easy gives you a self-hosted VPN with a clean web UI in under 30 minutes. Where it fits, where it doesn't, and the deployment patterns I run for managed clients.Sun, 24 Mar 2024 00:00:00 GMTcybersecurity-hardeningopen-source-solutionswireguardwg-easyvpnself-hostedzero-trustremote-worksimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/operations-automation/meshcentral-open-source-rmm-platform/https://webnestify.cloud/insights/operations-automation/meshcentral-open-source-rmm-platform/MeshCentral is a free, self-hosted Remote Monitoring and Management platform. Why I default to it over commercial RMM vendors after the ConnectWise breach made the closed-source RMM model look very different.Sun, 03 Mar 2024 00:00:00 GMToperations-automationopen-source-solutionsmeshcentralrmmremote-monitoringself-hostedopen-sourceit-managementsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/operations-automation/server-monitoring-grafana-prometheus-netdata/https://webnestify.cloud/insights/operations-automation/server-monitoring-grafana-prometheus-netdata/What real server and web app monitoring looks like in practice. The Grafana + Prometheus + Loki + Promtail stack for full control, Netdata for instant deployment, and how to pick between them.Sun, 04 Feb 2024 00:00:00 GMToperations-automationopen-source-solutionsserver-monitoringgrafanaprometheuslokinetdataobservabilityuptime-kumasimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cloud-infrastructure/litespeed-enterprise-web-server-performance/https://webnestify.cloud/insights/cloud-infrastructure/litespeed-enterprise-web-server-performance/LiteSpeed Enterprise is the web server I default to for WordPress and high-traffic PHP workloads. The technical reasons (event-driven architecture, LSCache, HTTP/3, .htaccess compatibility) and the business reasons it earns its license fee.Mon, 22 Jan 2024 00:00:00 GMTcloud-infrastructuretechnical-blueprintslitespeedweb-serverwordpressperformancehttp3quiccachingsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cloud-infrastructure/web-server-performance-benchmarks-litespeed-vs-apache-vs-nginx/https://webnestify.cloud/insights/cloud-infrastructure/web-server-performance-benchmarks-litespeed-vs-apache-vs-nginx/Real benchmarks on identical hardware: LiteSpeed Enterprise vs Apache vs Nginx for WordPress, with and without caching plugins. The numbers, the setup, and what they mean for your site.Mon, 22 Jan 2024 00:00:00 GMTcloud-infrastructuretechnical-blueprintslitespeedapachenginxbenchmarkswordpress-performanceload-testingsimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/open-source-solutions/ditch-google-analytics-foss-privacy-alternatives/https://webnestify.cloud/insights/open-source-solutions/ditch-google-analytics-foss-privacy-alternatives/Matomo, Plausible, Umami, and Ackee compared as open-source alternatives to Google Analytics. GDPR-compliant by default, self-hostable, and immune to ad-blockers when run on your own domain.Thu, 11 Jan 2024 00:00:00 GMTopen-source-solutionscybersecurity-hardeninganalyticsmatomoplausibleumamiackeegdprprivacygoogle-analyticssimon@webnestify.cloud (Simon Gajdosik)https://webnestify.cloud/insights/cybersecurity-hardening/cybersecurity-threats-modern-business/https://webnestify.cloud/insights/cybersecurity-hardening/cybersecurity-threats-modern-business/A grounded look at the cybersecurity threats modern businesses face today, where the standard defenses fall short, and what the practical fixes look like.Tue, 02 Jan 2024 00:00:00 GMTcybersecurity-hardeningagency-growth-strategycybersecurityransomwarephishingcloud-securitysupply-chain-securityinsider-threatszero-trustsimon@webnestify.cloud (Simon Gajdosik)